Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 18 of 18 results

(reset)

TPRKB Rabbit Polyclonal Antibody

TA345074

USD 475.00

5 Days

Rabbit Polyclonal Anti-TPRKB Antibody - middle region

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-TPRKB antibody: synthetic peptide directed towards the middle region of human TPRKB. Synthetic peptide located within the following region: EGTIDGSLINPTVIVDPFQILVAANKAVHLYKLGKMKTRTLSTEIIFNLS

TPRKB Rabbit Polyclonal Antibody

TA308096

USD 415.00

5 Days

Rabbit polyclonal antibody to TPRKB (TP53RK binding protein)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 1 and 175 of TPRKB (Uniprot ID#Q9Y3C4)

1 / 3

2 / 3

3 / 3

Previous Next

TPRKB Mouse Monoclonal Antibody [Clone ID: OTI3E3]

CF800155

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) TPRKB mouse monoclonal antibody, clone OTI3E3 (formerly 3E3)

Applications	FC, IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

TPRKB Mouse Monoclonal Antibody [Clone ID: OTI3H3]

CF800166

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) TPRKB mouse monoclonal antibody, clone OTI3H3 (formerly 3H3)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse
Conjugation	Unconjugated

• 

1 / 16

2 / 16

3 / 16

4 / 16

5 / 16

6 / 16

7 / 16

8 / 16

9 / 16

10 / 16

11 / 16

12 / 16

13 / 16

14 / 16

15 / 16

16 / 16

Previous Next

TPRKB Mouse Monoclonal Antibody [Clone ID: OTI1E9]

CF800238

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) TPRKB mouse monoclonal antibody, clone OTI1E9 (formerly 1E9)

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated

• 

1 / 18

2 / 18

3 / 18

4 / 18

5 / 18

6 / 18

7 / 18

8 / 18

9 / 18

10 / 18

11 / 18

12 / 18

13 / 18

14 / 18

15 / 18

16 / 18

17 / 18

18 / 18

Previous Next

TPRKB Rabbit Polyclonal Antibody

TA361799

USD 360.00

5 Days

TPRKB Antibody - N-terminal region

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human TPRKB

TPRKB Mouse Monoclonal Antibody [Clone ID: OTI3E3]

TA800155

USD 379.00

In Stock

TPRKB mouse monoclonal antibody, clone OTI3E3 (formerly 3E3)

Applications	FC, IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

TPRKB Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3E3]

TA800155AM

USD 420.00

5 Days

TPRKB mouse monoclonal antibody,clone 3E3, Biotinylated

Applications	FC, IHC, WB
Reactivities	Human, Mouse
Conjugation	Biotin

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

TPRKB Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3E3]

TA800155BM

USD 420.00

5 Days

TPRKB mouse monoclonal antibody,clone 3E3, HRP conjugated

Applications	FC, IHC, WB
Reactivities	Human, Mouse
Conjugation	HRP

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

TPRKB Mouse Monoclonal Antibody [Clone ID: OTI3E3]

TA800155S

USD 159.00

2 Days

TPRKB mouse monoclonal antibody, clone OTI3E3 (formerly 3E3)

Applications	FC, IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

TPRKB Mouse Monoclonal Antibody [Clone ID: OTI3H3]

TA800166

USD 379.00

In Stock

TPRKB mouse monoclonal antibody, clone OTI3H3 (formerly 3H3)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse
Conjugation	Unconjugated

• 

1 / 16

2 / 16

3 / 16

4 / 16

5 / 16

6 / 16

7 / 16

8 / 16

9 / 16

10 / 16

11 / 16

12 / 16

13 / 16

14 / 16

15 / 16

16 / 16

Previous Next

TPRKB Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3H3]

TA800166AM

USD 420.00

5 Days

TPRKB mouse monoclonal antibody,clone 3H3, Biotinylated

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse
Conjugation	Biotin

• 

1 / 16

2 / 16

3 / 16

4 / 16

5 / 16

6 / 16

7 / 16

8 / 16

9 / 16

10 / 16

11 / 16

12 / 16

13 / 16

14 / 16

15 / 16

16 / 16

Previous Next

TPRKB Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3H3]

TA800166BM

USD 420.00

5 Days

TPRKB mouse monoclonal antibody,clone 3H3, HRP conjugated

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse
Conjugation	HRP

• 

1 / 16

2 / 16

3 / 16

4 / 16

5 / 16

6 / 16

7 / 16

8 / 16

9 / 16

10 / 16

11 / 16

12 / 16

13 / 16

14 / 16

15 / 16

16 / 16

Previous Next

TPRKB Mouse Monoclonal Antibody [Clone ID: OTI3H3]

TA800166S

USD 159.00

2 Days

TPRKB mouse monoclonal antibody, clone OTI3H3 (formerly 3H3)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse
Conjugation	Unconjugated

• 

1 / 16

2 / 16

3 / 16

4 / 16

5 / 16

6 / 16

7 / 16

8 / 16

9 / 16

10 / 16

11 / 16

12 / 16

13 / 16

14 / 16

15 / 16

16 / 16

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

TPRKB Mouse Monoclonal Antibody [Clone ID: OTI1E9]

TA800238

USD 379.00

In Stock

TPRKB mouse monoclonal antibody, clone OTI1E9 (formerly 1E9)

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated

• 

1 / 18

2 / 18

3 / 18

4 / 18

5 / 18

6 / 18

7 / 18

8 / 18

9 / 18

10 / 18

11 / 18

12 / 18

13 / 18

14 / 18

15 / 18

16 / 18

17 / 18

18 / 18

Previous Next

TPRKB Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E9]

TA800238AM

USD 420.00

5 Days

TPRKB mouse monoclonal antibody,clone 1E9, Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Biotin

• 

1 / 18

2 / 18

3 / 18

4 / 18

5 / 18

6 / 18

7 / 18

8 / 18

9 / 18

10 / 18

11 / 18

12 / 18

13 / 18

14 / 18

15 / 18

16 / 18

17 / 18

18 / 18

Previous Next

TPRKB Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E9]

TA800238BM

USD 420.00

5 Days

TPRKB mouse monoclonal antibody,clone 1E9, HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	HRP

• 

1 / 18

2 / 18

3 / 18

4 / 18

5 / 18

6 / 18

7 / 18

8 / 18

9 / 18

10 / 18

11 / 18

12 / 18

13 / 18

14 / 18

15 / 18

16 / 18

17 / 18

18 / 18

Previous Next

TPRKB Mouse Monoclonal Antibody [Clone ID: OTI1E9]

TA800238S

USD 159.00

2 Days

TPRKB mouse monoclonal antibody, clone OTI1E9 (formerly 1E9)

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated

• 

1 / 18

2 / 18

3 / 18

4 / 18

5 / 18

6 / 18

7 / 18

8 / 18

9 / 18

10 / 18

11 / 18

12 / 18

13 / 18

14 / 18

15 / 18

16 / 18

17 / 18

18 / 18

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

1 - 18 of 18 results