Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal TRAF-6 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to amino acids 451-469 (DAKPELLAFQRPTIPRNPK) of human TRAF6 was used as immunogen, GenBank no. NP_665802.1. |
TRAF6 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide surrounding amino acid 436 of rat TRAF6 |
Rabbit Polyclonal anti-TRAF6 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRAF6 antibody: synthetic peptide directed towards the middle region of human TRAF6. Synthetic peptide located within the following region: YVTFMHLEALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDAGV |
Rabbit Polyclonal Anti-TRAF6 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TRAF6 antibody is: synthetic peptide directed towards the C-terminal region of Human TRAF6. Synthetic peptide located within the following region: FGYVTFMHLEALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDA |
Rabbit Polyclonal TRAF-6 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Anti-TRAF6 polyclonal antibody was raised against a peptide corresponding to amino acids between 410 and 460 of human TRAF6. |
Anti-TRAF6 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 350-522 amino acids of human TNF receptor-associated factor 6, E3 ubiquitin protein ligase |
TRAF6 Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse TRAF6 |
TRAF6 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human TRAF6. |
TRAF6 Rabbit monoclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- TRAF6