Antibodies

View as table Download

Anti-TRAF6 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 350-522 amino acids of human TNF receptor-associated factor 6, E3 ubiquitin protein ligase

Rabbit anti-TRAF6 Polyclonal Antibody

Applications ELISA, ICC/IF, IF
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

TRAF6 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal TRAF6 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TRAF6 antibody was raised against a peptide corresponding to 14 amino acids near the C-terminus of human TRAF6.

Rabbit Polyclonal TRAF-6 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to amino acids 451-469 (DAKPELLAFQRPTIPRNPK) of human TRAF6 was used as immunogen, GenBank no. NP_665802.1.

TRAF6 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide surrounding amino acid 436 of rat TRAF6

Rabbit Polyclonal anti-TRAF6 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRAF6 antibody: synthetic peptide directed towards the middle region of human TRAF6. Synthetic peptide located within the following region: YVTFMHLEALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDAGV

Rabbit Polyclonal Anti-TRAF6 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-TRAF6 antibody is: synthetic peptide directed towards the C-terminal region of Human TRAF6. Synthetic peptide located within the following region: FGYVTFMHLEALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDA

Rabbit Polyclonal TRAF-6 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Anti-TRAF6 polyclonal antibody was raised against a peptide corresponding to amino acids between 410 and 460 of human TRAF6.

Anti-TRAF6 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 350-522 amino acids of human TNF receptor-associated factor 6, E3 ubiquitin protein ligase

TRAF6 Antibody - middle region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse TRAF6

TRAF6 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human TRAF6.

TRAF6 Rabbit monoclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated