Rabbit Polyclonal Anti-TRAK1 Antibody
| Applications | WB |
| Reactivities | Human, Rabbit, Rat, Dog, Pig, Horse, Cow |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRAK1 antibody: synthetic peptide directed towards the middle region of human TRAK1. Synthetic peptide located within the following region: ILETEAADLGNDERSKKPGTPGTPGSHDLETALRRLSLRRENYLSERRFF |
Rabbit Polyclonal Anti-TRAK1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRAK1 antibody: synthetic peptide directed towards the middle region of human TRAK1. Synthetic peptide located within the following region: IYGYDHDDWLHTPLISPDANIDLTTEQIEETLKYFLLCAERVGQMTKTYN |
Goat Polyclonal Antibody against TRAK1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CGAKLSKQTSLR, from the C Terminus of the protein sequence according to NP_055780. |
Germany
Japan
United Kingdom
China
