Antibodies

View as table Download

Rabbit Polyclonal Anti-TRAPPC1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRAPPC1 antibody: synthetic peptide directed towards the middle region of human TRAPPC1. Synthetic peptide located within the following region: YKLMYGMLFSIRSFVSKMSPLDMKDGFLAFQTSRYKLHYYETPTGIKVVM

TRAPPC1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human TRAPPC1

TRAPPC1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human TRAPPC1