Germany
Japan
United Kingdom
China
TRAPPC2 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 10-39 amino acids from the N-terminal region of human TRAPPC2 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-Trappc2 Antibody
| Applications | WB |
| Reactivities | Rat |
| Immunogen | The immunogen for Anti-Trappc2 antibody is: synthetic peptide directed towards the N-terminal region of Rat Trappc2. Synthetic peptide located within the following region: FVIVGHHDNPVFEMEFLPPGKAESKDDHRHLNQFIAHAALDLVDENMWLS |
Rabbit Polyclonal Anti-TRAPPC2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRAPPC2 antibody: synthetic peptide directed towards the middle region of human TRAPPC2. Synthetic peptide located within the following region: RQEDGIKNFFTDVYDLYIKFSMNPFYEPNSPIRSSAFDRKVQFLGKKHLL |
TRAPPC2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human TRAPPC2 (NP_055378.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- TRAPPC2