Rabbit Polyclonal Anti-TRIB1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRIB1 antibody: synthetic peptide directed towards the middle region of human TRIB1. Synthetic peptide located within the following region: TEERTQLRLESLEDTHIMKGEDDALSDKHGCPAYVSPEILNTTGTYSGKA |
Goat Anti-Trib1 (mouse) (aa304-317) Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence PEHVSPKARCLIRS, from the internal region of the protein sequence according to NP_653132.1. |
Rabbit Polyclonal Anti-TRIB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRIB1 antibody: synthetic peptide directed towards the C terminal of human TRIB1. Synthetic peptide located within the following region: REPSERLTAPEILLHPWFESVLEPGYIDSEIGTSDQIVPEYQEDSDISSF |
Carrier-free (BSA/glycerol-free) TRIB1 mouse monoclonal antibody, clone OTI1B11 (formerly 1B11)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TRIB1 mouse monoclonal antibody, clone OTI1F11 (formerly 1F11)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
TRIB1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 203-372 of human TRIB1 (NP_079471.1). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
TRIB1 mouse monoclonal antibody, clone OTI1B11 (formerly 1B11)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
TRIB1 mouse monoclonal antibody, clone OTI1B11 (formerly 1B11), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
TRIB1 mouse monoclonal antibody, clone OTI1B11 (formerly 1B11), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
TRIB1 mouse monoclonal antibody, clone OTI1B11 (formerly 1B11)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
TRIB1 mouse monoclonal antibody, clone OTI1F11 (formerly 1F11)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
TRIB1 mouse monoclonal antibody, clone OTI1F11 (formerly 1F11), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
TRIB1 mouse monoclonal antibody, clone OTI1F11 (formerly 1F11), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
TRIB1 mouse monoclonal antibody, clone OTI1F11 (formerly 1F11)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
