Rabbit Polyclonal Anti-TRIM62 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRIM62 antibody: synthetic peptide directed towards the N terminal of human TRIM62. Synthetic peptide located within the following region: CSICLSIYQDPVSLGCEHYFCRRCITEHWVRQEAQGARDCPECRRTFAEP |
Rabbit Polyclonal Anti-TRIM62 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRIM62 antibody: synthetic peptide directed towards the middle region of human TRIM62. Synthetic peptide located within the following region: GLLIFYNADDMSWLYTFREKFPGKLCSYFSPGQSHANGKNVQPLRINTVR |
Rabbit Polyclonal Anti-TRIM62 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRIM62 antibody: synthetic peptide directed towards the N terminal of human TRIM62. Synthetic peptide located within the following region: RALLCFFCDEPALHEQHQVTGIDDAFDELQRELKDQLQALQDSEREHTEA |
TRIM62 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 120-280 of human TRIM62 (NP_060677.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
