Rabbit Polyclonal Anti-TRIT1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRIT1 antibody: synthetic peptide directed towards the C terminal of human TRIT1. Synthetic peptide located within the following region: SHLNQLKKRRRLDSDAVNTIESQSVSPDHNKEPKEKGSPGQNDQELKCSV |
Rabbit Polyclonal Anti-TRIT1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TRIT1 Antibody: synthetic peptide directed towards the middle region of human TRIT1. Synthetic peptide located within the following region: PHDKRKVARSLQVFEETGISHSEFLHRQHTEEGGGPLGGPLKFSNPCILW |
Trit1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
TRIT1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 48-300 of human TRIT1 (NP_060116.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China