Antibodies

Jump to Filters
View as table Download
TSPAN4 Rabbit Polyclonal Antibody
TA336051

USD 375.00

5 Days

Rabbit Polyclonal Anti-TSPAN4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TSPAN4 Antibody: synthetic peptide directed towards the middle region of human TSPAN4. Synthetic peptide located within the following region: YTDKIDRYAQQDLKKGLHLYGTQGNVGLTNAWSIIQTDFRCCGVSNYTDW
TSPAN4 Rabbit Polyclonal Antibody
TA382904

USD 220.00

3 Weeks

TSPAN4 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 107-201 of human TSPAN4 (NP_003262.1).
Modifications Unmodified