Antibodies

View as table Download

Rabbit Polyclonal Anti-TTC19 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-TTC19 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LAAILIHRERYTQAKEIYQEALKRAELKRDEVSVQHIREELAELSRKSRR

Rabbit Polyclonal Anti-TTC19 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-TTC19 antibody: synthetic peptide directed towards the N terminal of mouse TTC19. Synthetic peptide located within the following region: RTRGAPARGHGVLPLLAALAWFSRPAATAEQPGEDASDEAEAEIIQLLKQ