Rabbit Polyclonal Anti-Tut1 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Tut1 antibody is: synthetic peptide directed towards the N-terminal region of Rat Tut1. Synthetic peptide located within the following region: MAAVDSDVVSLPRGRFRCCLCDVTTANRPSLDAHLKGRKHRDLVQLRATR |
Rabbit Polyclonal Anti-TUT1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TUT1 antibody: synthetic peptide directed towards the middle region of human TUT1. Synthetic peptide located within the following region: EGAGGGAGTRAGWLATEAQVTQELKGLSGGEERPETEPLLSFVASVSPAD |
Rabbit polyclonal anti-TUT1 antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TUT1. |
Rabbit Polyclonal Anti-TUT1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TUT1 Antibody: synthetic peptide directed towards the N terminal of human TUT1. Synthetic peptide located within the following region: CDLDLFLDLGDLEEPQPVPKAPESPSLDSALASPLDPQALACTPASPPDS |
Germany
Japan
United Kingdom
China