Rabbit Polyclonal Anti-TXNDC9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TXNDC9 Antibody is: synthetic peptide directed towards the N-terminal region of Human TXNDC9. Synthetic peptide located within the following region: VDMFSKVLEHQLLQTTKLVEEHLDSEIQKLDQMDEDELERLKEKRLQALR |
TXNDC9 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human TXNDC9 |
TXNDC9 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human TXNDC9 (NP_005774.2). |
| Modifications | Unmodified |
USD 380.00
4 Weeks
Germany
Japan
United Kingdom
China
