Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-U2AF2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-U2AF2 antibody: synthetic peptide directed towards the N terminal of human U2AF2. Synthetic peptide located within the following region: EFERQLNENKQERDKENRHRKRSHSRSRSRDRKRRSRSRDRRNRDQRSAS |
Rabbit Polyclonal Anti-U2AF2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-U2AF2 antibody: synthetic peptide directed towards the C terminal of human U2AF2. Synthetic peptide located within the following region: TEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGV |
U2AF2 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human U2AF2 |
Active filters
Target Symbol
- U2AF2