Germany
Japan
United Kingdom
China
Rabbit anti-UBE2D1 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human UBE2D1 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-MKRN1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MKRN1 antibody: synthetic peptide directed towards the N terminal of human MKRN1. Synthetic peptide located within the following region: GDRCRYEHSKPLKQEEATATELTTKSSLAASSSLSSIVGPLVEMNTGEAE |
Carrier-free (BSA/glycerol-free) UBE2D1 mouse monoclonal antibody, clone OTI1E7 (formerly 1E7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
UBE2D1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human UBE2D1 |
UBE2D1 mouse monoclonal antibody, clone OTI1E7 (formerly 1E7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
UBE2D1 mouse monoclonal antibody, clone OTI1E7 (formerly 1E7), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
UBE2D1 mouse monoclonal antibody, clone OTI1E7 (formerly 1E7), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
UBE2D1 mouse monoclonal antibody, clone OTI1E7 (formerly 1E7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- UBE2D1