Rabbit Polyclonal Anti-UBE2D4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-UBE2D4 antibody is: synthetic peptide directed towards the C-terminal region of Human UBE2D4. Synthetic peptide located within the following region: ALTVSKVLLSICSLLCDPNPDDPLVPEIAHTYKADREKYNRLAREWTQKY |
UBE2D4 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-147 of human UBE2D4 (NP_057067.1). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
UBE2D4 mouse monoclonal antibody,clone OTI1B1
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Germany
Japan
United Kingdom
China
