Goat Anti-UBE2F / NCE2 (N Terminus) Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence SKLKRDDGLKGSRT-C, from the N Terminus of the protein sequence according to NP_542409.1. |
Goat Anti-UBE2F / NCE2 (N Terminus) Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence SKLKRDDGLKGSRT-C, from the N Terminus of the protein sequence according to NP_542409.1. |
Rabbit Polyclonal Anti-UBE2F Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UBE2F antibody: synthetic peptide directed towards the N terminal of human UBE2F. Synthetic peptide located within the following region: MLTLASKLKRDDGLKGSRTAATASDSTRRVSVRDKLLVKEVAELEANLPC |
Rabbit Polyclonal Anti-UBE2F Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UBE2F antibody: synthetic peptide directed towards the middle region of human UBE2F. Synthetic peptide located within the following region: TLKDVVWGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRNKVDDYIKRYA |
UBE2F rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human UBE2F |
UBE2F rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human UBE2F |
UBE2F Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-185 of human UBE2F (NP_542409.1). |
Modifications | Unmodified |