Germany
Japan
United Kingdom
China
Goat Anti-UBE2F / NCE2 (N Terminus) Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence SKLKRDDGLKGSRT-C, from the N Terminus of the protein sequence according to NP_542409.1. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-UBE2F Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UBE2F antibody: synthetic peptide directed towards the N terminal of human UBE2F. Synthetic peptide located within the following region: MLTLASKLKRDDGLKGSRTAATASDSTRRVSVRDKLLVKEVAELEANLPC |
Rabbit Polyclonal Anti-UBE2F Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UBE2F antibody: synthetic peptide directed towards the middle region of human UBE2F. Synthetic peptide located within the following region: TLKDVVWGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRNKVDDYIKRYA |
UBE2F rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human UBE2F |
UBE2F Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-185 of human UBE2F (NP_542409.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- UBE2F