Antibodies

View as table Download

UBE2I Rabbit Polyclonal Antibody

Applications ELISA, ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

UBE2I rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human UBE2I

Rabbit Polyclonal Anti-SLC38A4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SLC38A4 antibody: synthetic peptide directed towards the middle region of human SLC38A4. Synthetic peptide located within the following region: LAALFGYLTFYGEVEDELLHAYSKVYTLDIPLLMVRLAVLVAVTLTVPIV

Goat Polyclonal Antibody against UBE2I

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence SGIALSRLAQERK-C, from the N Terminus of the protein sequence according to NP_003336.1; NP_919235.1; NP_919236.1; NP_919237.1.

UBE2I Antibody - N-terminal region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human UBE2I

UBE2I rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human UBE2I

UBE2I Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-158 of human UBE2I (NP_003336.1).
Modifications Unmodified

SUMO Conjugating Enzyme UBC9 Rabbit polyclonal Antibody

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human UBE2I

SUMO Conjugating Enzyme UBC9 Rabbit monoclonal Antibody

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Recombinant Anti-UBE2I (Clone SAIC-36A-9)

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated

Rabbit polyclonal anti-UBE2I Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human UBE2I

Rabbit polyclonal anti-UBE2I Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human UBE2I