Rabbit Polyclonal Anti-UBE2K Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UBE2K antibody: synthetic peptide directed towards the middle region of human UBE2K. Synthetic peptide located within the following region: TVLLSLQALLAAAEPDDPQDAVVANQYKQNPEMFKQTARLWAHVYAGAPV |
Rabbit Polyclonal Anti-UBE2K Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UBE2K antibody: synthetic peptide directed towards the N terminal of human UBE2K. Synthetic peptide located within the following region: FTELRGEIAGPPDTPYEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNIS |
HIP2 (UBE2K) (144-157) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Bat, Bovine, Canine, Chicken, Equine, Goat, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Xenopus, Zebrafish |
| Immunogen | Synthetic peptide from C-terminus of human HIP2 (aa 144-157) |
Goat Polyclonal Antibody against HIP2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SWDVETATELLLSN, from the C Terminus of the protein sequence according to NP_005330. |
Anti-UBE2K Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Rabbit polyclonal UBE2K Antibody(N-term)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This UBE2K antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 2-30 amino acids from the N-terminal region of human UBE2K. |
HIP2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human HIP2 |
UBE2K Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human UBE2K |
UBE2K Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human UBE2K (NP_005330.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
