Rabbit Polyclonal Anti-UBE2T Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UBE2T antibody: synthetic peptide directed towards the N terminal of human UBE2T. Synthetic peptide located within the following region: MQRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGV |
Rabbit polyclonal anti-UBE2T antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human UBE2T. |
Goat Polyclonal Antibody against HSPC150 / UBE2T
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QLVGIEKKFHPDV, from the C Terminus of the protein sequence according to NP_054895.1. |
UBE2T rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
UBE2T Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-197 of human UBE2T (NP_054895.1). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Germany
Japan
United Kingdom
China
