Rabbit Polyclonal Antibody against UBQLN1 (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This Ubiquilin1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 296-326 amino acids from the Central region of human Ubiquilin1. |
UBQLN1 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human UBQLN1 |
Rabbit Polyclonal Anti-UBQLN1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UBQLN1 antibody: synthetic peptide directed towards the middle region of human UBQLN1. Synthetic peptide located within the following region: QFGGNPFASLVSNTSSGEGSQPSRTENRDPLPNPWAPQTSQSSSASSGTA |
Rabbit polyclonal Ubiquilin1 (PLIC1) Antibody (N-term)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This Ubiquilin1 (PLIC1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 19-49 amino acids from the N-terminal region of human Ubiquilin1 (PLIC1). |
Rabbit Polyclonal Antibody against UBQLN1 (N-term)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This Ubiquilin1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 40-70 amino acids from the N-terminal region of human Ubiquilin1. |
UBQLN1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 480-540 of human UBQLN1 (NP_038466.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
