Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-UBQLN3 antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human UBQLN3. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-UBQLN3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-UBQLN3 Antibody: synthetic peptide directed towards the N terminal of human UBQLN3. Synthetic peptide located within the following region: LMRQHVSVPEFVTQLIDDPFIPGLLSNTGLVRQLVLDNPHMQQLIQHNPE |
UBQLN3 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 306-620 of human UBQLN3 (NP_059509.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- UBQLN3