Rabbit Polyclonal Anti-UBR7 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C14orf130 antibody: synthetic peptide directed towards the middle region of human C14orf130. Synthetic peptide located within the following region: MIQCVVCEDWFHGRHLGAIPPESGDFQEMVCQACMKRCSFLWAYAAQLAV |
Rabbit Polyclonal Anti-UBR7 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C14orf130 antibody: synthetic peptide directed towards the C terminal of human C14orf130. Synthetic peptide located within the following region: DRSDPLMDTLSSMNRVQQVELICEYNDLKTELKDYLKRFADEGTVVKRED |
Rabbit Polyclonal Anti-Ubr7 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Ubr7 Antibody is: synthetic peptide directed towards the N-terminal region of RAT Ubr7. Synthetic peptide located within the following region: HGSHKLFELYTKRNFRCDCGNSKFKNLECKLFPDKSKVNSCNKYNDNFFG |
Rabbit Polyclonal Anti-C14orf130 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-C14orf130 Antibody: synthetic peptide directed towards the N terminal of human C14orf130. Synthetic peptide located within the following region: MAGAEGAAGRQSELEPVVSLVDVLEEDEELENEACAVLGGSDSEKCSYSQ |
UBR7 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human UBR7 |
UBR7 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 76-425 of human UBR7 (NP_786924.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
