Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-Ubtf Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Ubtf antibody is: synthetic peptide directed towards the N-terminal region of Rat Ubtf. Synthetic peptide located within the following region: TDLEMAAPKGQDRWSQEDMLTLLECMKNNLPSNDSSKFKTTESHMDWEKV |
Rabbit polyclonal UBF (Ser484) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human UBF around the phosphorylation site of serine 484 (P-E-SP-P-K). |
| Modifications | Phospho-specific |
UBF1 (UBTF) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 630-660 amino acids from the C-terminal region of human UBTF |
Rabbit Polyclonal Anti-UBTF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-UBTF Antibody: synthetic peptide directed towards the middle region of human UBTF. Synthetic peptide located within the following region: LESLPEEEQQRVLGEEKMLNINKKQATSPASKKPAQEGGKGGSEKPKRPV |
UBTF Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human UBF1 |
UBTF Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 200-440 of human UBTF (NP_055048.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- UBTF