Antibodies

View as table Download

UBXN10 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human UBXN10

Rabbit Polyclonal Anti-UBXN10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UBXD3 antibody: synthetic peptide directed towards the middle region of human UBXD3. Synthetic peptide located within the following region: PYELPSSQKPGACAPKSPNQGASDEIPELQQQVPTGASSSLNKYPVLPSI

Carrier-free (BSA/glycerol-free) UBXN10 mouse monoclonal antibody, clone OTI1H5 (formerly 1H5)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) UBXN10 mouse monoclonal antibody, clone OTI2F6 (formerly 2F6)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

UBXN10 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human UBXN10

Anti-UBXN10 mouse monoclonal antibody, clone OTI1H5 (formerly 1H5)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

Anti-UBXN10 mouse monoclonal antibody, clone OTI1H5 (formerly 1H5)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

Anti-UBXN10 mouse monoclonal antibody, clone OTI2F6 (formerly 2F6)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

Anti-UBXN10 mouse monoclonal antibody, clone OTI2F6 (formerly 2F6)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated