UBXN10 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human UBXN10 |
UBXN10 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human UBXN10 |
Rabbit Polyclonal Anti-UBXN10 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UBXD3 antibody: synthetic peptide directed towards the middle region of human UBXD3. Synthetic peptide located within the following region: PYELPSSQKPGACAPKSPNQGASDEIPELQQQVPTGASSSLNKYPVLPSI |
Carrier-free (BSA/glycerol-free) UBXN10 mouse monoclonal antibody, clone OTI1H5 (formerly 1H5)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) UBXN10 mouse monoclonal antibody, clone OTI2F6 (formerly 2F6)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
UBXN10 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human UBXN10 |
Anti-UBXN10 mouse monoclonal antibody, clone OTI1H5 (formerly 1H5)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-UBXN10 mouse monoclonal antibody, clone OTI1H5 (formerly 1H5), Biotinylated
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
Anti-UBXN10 mouse monoclonal antibody, clone OTI1H5 (formerly 1H5), HRP conjugated
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | HRP |
Anti-UBXN10 mouse monoclonal antibody, clone OTI1H5 (formerly 1H5)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-UBXN10 mouse monoclonal antibody, clone OTI2F6 (formerly 2F6)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-UBXN10 mouse monoclonal antibody, clone OTI2F6 (formerly 2F6), Biotinylated
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
Anti-UBXN10 mouse monoclonal antibody, clone OTI2F6 (formerly 2F6), HRP conjugated
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | HRP |
Anti-UBXN10 mouse monoclonal antibody, clone OTI2F6 (formerly 2F6)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |