ULK1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ULK1 |
ULK1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ULK1 |
Rabbit polyclonal APG1 (ULK1) Antibody (Center)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This APG1 (ULK1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 642-672 amino acids from the Central region of human APG1 (ULK1). |
Rabbit Polyclonal ULK1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ULK1 antibody was raised against a 16 amino acid peptide near the center of human ULK1 . |
ULK1 rabbit polyclonal antibody, Purified
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide selected from Human Unc-51-like kinase 1 (ULK1) |
Rabbit Polyclonal ULK1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to amino acids between 320 and 370 of human ULK1 was used as the immunogen, GenBank no. sp O75385.2 ULK1_HUMAN. |
Rabbit Polyclonal Anti-ULK1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ULK1 Antibody is: synthetic peptide directed towards the N-terminal region of Human ULK1. Synthetic peptide located within the following region: PEVIMSQHYDGKADLWSIGTIVYQCLTGKAPFQASSPQDLRLFYEKNKTL |
ULK1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ULK1 |
ULK1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 400-499 of human ULK1 (NP_003556.1). |
| Modifications | Unmodified |
Phospho-ULK1-S757 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic phosphorylated peptide around S757 of human Phospho-ULK1-S757 (NP_003556.1). |
| Modifications | Phospho S757 |
Phospho-ULK1-S555 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic phosphorylated peptide around S555 of human Phospho-ULK1-S555 (NP_003556.1). |
| Modifications | Phospho S555 |
Phospho-ULK1-S638 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic phosphorylated peptide around S638 of human Phospho-ULK1-S638. |
| Modifications | Phospho S638 |
Phospho-ULK1-S467 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S467 of human ULK1 |
| Modifications | Phospho S467 |
ULK1/ULK2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ULK1/ULK2. |
ULK1 (phospho-Ser555) polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic phosphopeptide derived from human ULK1 around the phosphorylation site of Ser555. |
Rabbit monoclonal antibody to Anti-Phospho-ULk1 (Autophagy-related protein 1 homolog, ATG1) (Ser757)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |