Germany
Japan
United Kingdom
China
Uromucoid (UMOD) mouse monoclonal antibody, clone 10.32, FITC
| Applications | ELISA, IF, IHC |
| Reactivities | Canine, Human |
| Conjugation | FITC |
Antibodies
View as table DownloadUromucoid (UMOD) mouse monoclonal antibody, clone 10.32, HRP
| Applications | ELISA, IF, IHC, R |
| Reactivities | Canine, Human |
| Conjugation | HRP |
Uromucoid (UMOD) mouse monoclonal antibody, clone 10.32, Ascites
| Applications | ELISA, IF, IHC, R |
| Reactivities | Canine, Human |
Rabbit anti-UMOD Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human UMOD |
Rabbit Polyclonal Anti-UMOD Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UMOD antibody: synthetic peptide directed towards the middle region of human UMOD. Synthetic peptide located within the following region: MTNCYATPSSNATDPLKYFIIQDRCPHTRDSTIQVVENGESSQGRFSVQM |
Rabbit Polyclonal Anti-UMOD Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UMOD antibody: synthetic peptide directed towards the C terminal of human UMOD. Synthetic peptide located within the following region: PTCSGTRFRSGSVIDQSRVLNLGPITRKGVQATVSRAFSSLGLLKVWLPL |
Uromucoid (UMOD) mouse monoclonal antibody, clone 10.32, Purified
| Applications | ELISA, IF, IHC |
| Reactivities | Canine, Human |
Anti-UMOD Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 315-615 amino acids of human uromodulin |
Goat Anti-Uromodulin / UMOD Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-PITRKGVQATVS, from the C Terminus of the protein sequence according to NP_003352.2. |
Active filters
Target Symbol
- UMOD