Germany
Japan
United Kingdom
China
Goat Anti-UNC45B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RSDKLRQKIFKER, from the internal region of the protein sequence according to NP_775259.1; NP_001028748.1. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-UNC45B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UNC45B antibody is: synthetic peptide directed towards the C-terminal region of Human UNC45B. Synthetic peptide located within the following region: TLVNCTNSYDVKEVIPELVQLAKFSKQHVPEEHPKDKKDFIDMRVKRLLK |
UNC45B rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human UNC45B |
Active filters
Target Symbol
- UNC45B