Antibodies

View as table Download

USF1 Rabbit Polyclonal Antibody

Applications ELISA, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit polyclonal USF1 Antibody (Center)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This USF1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 174-201 amino acids from the Central region of human USF1.

Mouse monoclonal anti-USF1 antibody (Center)

Applications WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-USF1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-USF1 Antibody: synthetic peptide directed towards the N terminal of human USF1. Synthetic peptide located within the following region: KGQQKTAETEEGTVQIQEGAVATGEDPTSVAIASIQSAATFPDPNVKYVF

Rabbit Polyclonal Anti-USF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-USF1 Antibody: synthetic peptide directed towards the N terminal of human USF1. Synthetic peptide located within the following region: DPTSVAIASIQSAATFPDPNVKYVFRTENGGQVMYRVIQVSEGQLDGQTE

Rabbit Polyclonal Anti-USF1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-USF1 antibody: synthetic peptide directed towards the middle region of human USF1. Synthetic peptide located within the following region: IQELRQSNHRLSEELQGLDQLQLDNDVLRQQVEDLKNKNLLLRAQLRHHG

Rabbit Polyclonal Anti-USF1 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human USF1

USF1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human USF1

USF1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human USF1

USF1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human USF1

USF1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-310 of human USF1 (NP_009053.1).
Modifications Unmodified