Germany
Japan
United Kingdom
China
USF1 Rabbit Polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human USF1 |
Antibodies
View as table Download
Rabbit polyclonal USF1 Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This USF1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 174-201 amino acids from the Central region of human USF1. |
Mouse monoclonal anti-USF1 antibody (Center)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-USF1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-USF1 Antibody: synthetic peptide directed towards the N terminal of human USF1. Synthetic peptide located within the following region: KGQQKTAETEEGTVQIQEGAVATGEDPTSVAIASIQSAATFPDPNVKYVF |
Rabbit Polyclonal Anti-USF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-USF1 Antibody: synthetic peptide directed towards the N terminal of human USF1. Synthetic peptide located within the following region: DPTSVAIASIQSAATFPDPNVKYVFRTENGGQVMYRVIQVSEGQLDGQTE |
Rabbit Polyclonal Anti-USF1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-USF1 antibody: synthetic peptide directed towards the middle region of human USF1. Synthetic peptide located within the following region: IQELRQSNHRLSEELQGLDQLQLDNDVLRQQVEDLKNKNLLLRAQLRHHG |
Rabbit Polyclonal Anti-USF1 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human USF1 |
USF1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human USF1 |
USF1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human USF1 |
USF1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human USF1 |
USF1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-310 of human USF1 (NP_009053.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- USF1