Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-USP1 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human USP1 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-USP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-USP1 antibody: synthetic peptide directed towards the C terminal of human USP1. Synthetic peptide located within the following region: SETSDTTGTHESDRNKESSDQTGINISGFENKISYVVQSLKEYEGKWLLF |
USP1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 486-785 of human USP1 (NP_003359.3). |
| Modifications | Unmodified |
Active filters
Target Symbol
- USP1