Rabbit Polyclonal Anti-USP18 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-USP18 antibody: synthetic peptide directed towards the N terminal of human USP18. Synthetic peptide located within the following region: MQDSRQKAVRPLELAYCLQKCNVPLFVQHDAAQLYLKLWNLIKDQITDVH |
Rabbit polyclonal anti-UBP43 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding aa 40-49 of human UBP43 protein. |
USP18 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 200-300 of human USP18 (NP_059110.2). |
Germany
Japan
United Kingdom
China
