Antibodies

View as table Download

Rabbit Polyclonal Anti-UTY Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UTY antibody: synthetic peptide directed towards the middle region of human UTY. Synthetic peptide located within the following region: ESNRSHTTIAKYAQYQASSFQESLREENEKRTQHKDHSDNESTSSENSGR

UTY Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human UTY (NP_009056.3).
Modifications Unmodified

UTY (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 1254~1284 amino acids from the C-terminal region of human UTY

Rabbit Polyclonal Anti-UTY Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-UTY Antibody is: synthetic peptide directed towards the N-terminal region of Human UTY. Synthetic peptide located within the following region: NLLLEDYSKALSAYQRYYSLQADYWKNAAFLYGLGLVYFYYNAFHWAIKA

UTY Antibody - N-terminal region

Applications WB
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human UTY

UTY Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of human UTY

UTY rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Full length fusion protein

UTY rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length fusion protein