Rabbit Polyclonal Anti-UTY Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UTY antibody: synthetic peptide directed towards the middle region of human UTY. Synthetic peptide located within the following region: ESNRSHTTIAKYAQYQASSFQESLREENEKRTQHKDHSDNESTSSENSGR |
UTY Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human UTY (NP_009056.3). |
| Modifications | Unmodified |
Rabbit Polyclonal Anti-UTY Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-UTY Antibody is: synthetic peptide directed towards the N-terminal region of Human UTY. Synthetic peptide located within the following region: NLLLEDYSKALSAYQRYYSLQADYWKNAAFLYGLGLVYFYYNAFHWAIKA |
UTY Antibody - N-terminal region
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human UTY |
UTY Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of human UTY |
UTY rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Germany
Japan
United Kingdom
China
