Rabbit Polyclonal Anti-UBL3 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Ubl3 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: FLHGNVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGESNCCV |
Rabbit Polyclonal Anti-UBL3 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Ubl3 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Ubl3. Synthetic peptide located within the following region: VPADMINLRLILVSGKTKEFLFSPNDSASDIAKHVYDNWPMDWEEEQVSS |
Carrier-free (BSA/glycerol-free) UBL3 mouse monoclonal antibody, clone OTI1G4 (formerly 1G4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-UBL3 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
UBL3 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-117 of human UBL3 (NP_009037.1). |
| Modifications | Unmodified |
UBL3 mouse monoclonal antibody, clone OTI1G4 (formerly 1G4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
UBL3 mouse monoclonal antibody, clone OTI1G4 (formerly 1G4), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
UBL3 mouse monoclonal antibody, clone OTI1G4 (formerly 1G4), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
UBL3 mouse monoclonal antibody, clone OTI1G4 (formerly 1G4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China