Antibodies

Jump to Filters
View as table Download
UBXN2A (C-term) Rabbit Polyclonal Antibody
AP54450PU-N

USD 450.00

2 Weeks

UBXN2A (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 173-203 amino acids from the C-terminal region of human UBXN2A
Ubxn2a Rabbit Polyclonal Antibody
TA337589

USD 375.00

5 Days

Rabbit Polyclonal Anti-Ubxn2a Antibody

Applications WB
Reactivities Rat
Immunogen The immunogen for anti-Ubxn2a antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: VCMSTKPVFQPFSGQGHRLGSATPRIVSKAKSIEVDNKSTLSAVSLNNLE
UBXN2A Rabbit Polyclonal Antibody
TA350624

USD 345.00

In Stock

Rabbit Polyclonal Anti-UBXN2A Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human UBXN2A