Rabbit Polyclonal Anti-UCHL3 Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UCHL3 antibody: synthetic peptide directed towards the N terminal of human UCHL3. Synthetic peptide located within the following region: MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVC |
Rabbit Polyclonal Anti-UCHL3 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | UCHL3 antibody was raised against synthetic 15 amino acid peptide from near C-terminus of human UCHL3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bovine, Horse, Rabbit, Pig, Lizard (100%); Opossum, Turkey, Chicken (93%); Xenopus, Zebrafish, Drosophila (80%). |
Rabbit Polyclonal Anti-UCHL3 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | UCHL3 antibody was raised against synthetic 18 amino acid peptide from internal region of human UCHL3. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Dog, Bovine, Elephant, Panda, Horse (100%); Mouse, Rat, Rabbit, Pig (94%); Opossum (83%). |
Rabbit Polyclonal Anti-UCHL3 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | UCHL3 antibody was raised against synthetic 18 amino acid peptide from internal region of human UCHL3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Mouse, Rat, Dog, Elephant, Opossum, Turkey, Chicken, Lizard (100%); Orangutan, Monkey, Bovine, Horse, Rabbit, Pig, Salmon (94%); Pufferfish, Zebrafish, Stickleback, Water flea (89%); Xenopus (83%). |
Rabbit Polyclonal Anti-UCHL3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UCHL3 antibody: synthetic peptide directed towards the C terminal of human UCHL3. Synthetic peptide located within the following region: YELDGRKPFPINHGETSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA |
Rabbit Polyclonal Anti-UCHL3 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Uchl3 antibody is: synthetic peptide directed towards the middle region of Mouse Uchl3. Synthetic peptide located within the following region: IHAIANNKDKMHFESGSTLKKFLEESVSMSPEERAKFLENYDAIRVTHET |
UCHL3 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human UCHL3 |
UCHL3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human UCHL3 (NP_005993.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
