Antibodies

View as table Download

Rabbit Polyclonal Unc93b Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Unc93b antibody was raised against a 19 amino acid peptide from near the amino terminus of human Unc93b.

UNC93B (UNC93B1) (N-term) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen UNC93B antibody was raised against 19 amino acid peptide from near the amino terminus of human Unc93b

Rabbit Polyclonal Anti-UNC93B1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UNC93B1 antibody: synthetic peptide directed towards the N terminal of human UNC93B1. Synthetic peptide located within the following region: LKNVLAASAGGMLTYGVYLGLLQMQLILHYDETYREVKYGNMGLPDIDSK

Rabbit Polyclonal UNC93B Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A portion of amino acid 500-550 of mouse UNC93B protein was used as the immunogen.

UNC93B1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human UNC93B1

UNC93B1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 450-550 of human UNC93B1 (NP_112192.2).
Modifications Unmodified