Rabbit Polyclonal Anti-Unkl Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Unkl antibody is: synthetic peptide directed towards the N-terminal region of Mouse Unkl. Synthetic peptide located within the following region: IASLDKDLEEQDLGLTGLNGVPGSIWDFVSGSFSPSPSPILNSGPSASSS |
Rabbit Polyclonal Anti-Unkl Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Unkl antibody is: synthetic peptide directed towards the middle region of Mouse Unkl. Synthetic peptide located within the following region: IRQWEESWQQVKQACDAWQREAQEAKERARVADSDRQLALQRKEEVEAKV |
UNKL Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human UNKL |
UNKL rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human UNKL |
Germany
Japan
United Kingdom
China
