Antibodies

Jump to Filters
View as table Download
MNF1 (UQCC2) Rabbit Polyclonal Antibody
TA333617

USD 375.00

5 Days

Rabbit Polyclonal Anti-MNF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MNF1 Antibody is: synthetic peptide directed towards the C-terminal region of Human MNF1. Synthetic peptide located within the following region: DTSFSGLSLEEYKLILSTDTLEELKEIDKGMWKKLQEKFAPKGPEEDHKA
UQCC2 Rabbit Polyclonal Antibody
TA365934

USD 380.00

4 Weeks

UQCC2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human UQCC2
MNF1 (UQCC2) Rabbit Polyclonal Antibody
TA383122

USD 275.00

3 Weeks

UQCC2 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 14-126 of human UQCC2 (NP_115716.1).
Modifications Unmodified