Antibodies

Jump to Filters
View as table Download
USP54 Rabbit Polyclonal Antibody
TA334799

USD 375.00

5 Days

Rabbit Polyclonal Anti-USP54 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-USP54 antibody is: synthetic peptide directed towards the C-terminal region of Human USP54. Synthetic peptide located within the following region: TPGPRRVDMPPDDDWRQSSYASHSGHRRTVGEGFLFVLSDAPRREQIRAR
USP54 Mouse Monoclonal Antibody [Clone ID: OTI1G6]
CF800284

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) USP54 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated
USP54 Mouse Monoclonal Antibody [Clone ID: OTI1G6]
TA800284

USD 379.00

In Stock

USP54 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated
USP54 Mouse Monoclonal Antibody [Clone ID: OTI1G6]
TA800284S

USD 159.00

2 Days

USP54 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated