Antibodies

Jump to Filters
View as table Download
SYBL1 (VAMP7) Rabbit Polyclonal Antibody
TA383190

USD 275.00

3 Weeks

VAMP7 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human VAMP7.
SYBL1 (VAMP7) Rabbit Polyclonal Antibody
TA319712

USD 430.00

2 Weeks

Rabbit Polyclonal VAMP7 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen VAMP7 antibody was raised against an 18 amino acid synthetic peptide near the amino terminus of human VAMP7.
SYBL1 (VAMP7) Rabbit Polyclonal Antibody
TA342435

USD 375.00

5 Days

Rabbit Polyclonal Anti-VAMP7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VAMP7 antibody: synthetic peptide directed towards the N terminal of human VAMP7. Synthetic peptide located within the following region: KIPSENNKLTYSHGNYLFHYICQDRIVYLCITDDDFERSRAFNFLNEIKK
Vamp7 Rabbit Polyclonal Antibody
TA356664

USD 360.00

5 Days

Vamp7 Antibody - C-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated