Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-Vax1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Vax1 Antibody: synthetic peptide directed towards the N terminal of human Vax1. Synthetic peptide located within the following region: MFGKPDKMDVRCHSDAEAARVSKNAHKESRESKGAEGNLPAAFLKEPQGA |
Rabbit Polyclonal Anti-VAX1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-VAX1 Antibody is: synthetic peptide directed towards the N-terminal region of Human VAX1. Synthetic peptide located within the following region: HKESRESKGAEGNLPAAFLKEPQGAFSASGAAEDCNKSKSNSAADPDYCR |
Rabbit Polyclonal Anti-Vax1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Vax1 antibody: synthetic peptide directed towards the middle region of mouse Vax1. Synthetic peptide located within the following region: RERTELARQLNLSETQVKVWFQNRRTKQKKDQGKDSELRSVVSETAATCS |
Rabbit Polyclonal Anti-Vax1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Vax1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MFGKPDKMDVRCHSDTEAARVSKNAHKESREIKGAEGSLPAAFLKEPQGA |
Carrier-free (BSA/glycerol-free) VAX1 mouse monoclonal antibody,clone OTI1E7
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Vax1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide corresponding to a region of Mouse |
VAX1 mouse monoclonal antibody,clone OTI1E7
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
VAX1 mouse monoclonal antibody,clone OTI1E7, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
VAX1 mouse monoclonal antibody,clone OTI1E7, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
VAX1 mouse monoclonal antibody,clone OTI1E7
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- VAX1