Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-VENTX antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 76 of human VENTX |
Rabbit Polyclonal Anti-VENTX Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VENTX antibody: synthetic peptide directed towards the middle region of human VENTX. Synthetic peptide located within the following region: VAQEALASAGASCCGQPLASHPPTPGRPSLGPALSTGPRGLCAMPQTGDA |
Rabbit Polyclonal Anti-VENTX Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VENTX antibody: synthetic peptide directed towards the middle region of human VENTX. Synthetic peptide located within the following region: NLPAPERTMAGLSKEPNTLRAPRVRTAFTMEQVRTLEGVFQHHQYLSPLE |
VENTX rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
VENTX Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-258 of human VENTX (NP_055283.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- VENTX