Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal VGF Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | VGF antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of the human VGF. The immunogen is located within the last 50 amino acids of VGF. |
Rabbit Polyclonal Anti-VGF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VGF antibody: synthetic peptide directed towards the middle region of human VGF. Synthetic peptide located within the following region: ARQNALLFAEEEDGEAGAEDKRSQEETPGHRRKEAEGTEEGGEEEDDEEM |
Rabbit Polyclonal Anti-VGF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VGF antibody: synthetic peptide directed towards the middle region of human VGF. Synthetic peptide located within the following region: VRSPQPPPPAPAPARDELPDWNEVLPPWDREEDEVYPPGPYHPFPNYIRP |
VGF (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | 17 amino acid peptide near the carboxy terminus of the human VGF |
Rabbit Polyclonal Anti-VGF Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human VGF |
VGF Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 466-615 of human VGF (NP_003369.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- VGF