Rabbit Polyclonal Anti-VGLL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VGLL1 antibody: synthetic peptide directed towards the N terminal of human VGLL1. Synthetic peptide located within the following region: LFTYFQGDISSVVDEHFSRALSNIKSPQELTPSSQSEGVMLKNDDSMSPN |
Rabbit Polyclonal Anti-VGLL1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VGLL1 antibody: synthetic peptide directed towards the middle region of human VGLL1. Synthetic peptide located within the following region: RPQESAARENGNPGQIAGSTGLLFNLPPGSVHYKKLYVSRGSASTSLPNE |
VGLL1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 59-258 of human VGLL1 (NP_057351.1). |
| Modifications | Unmodified |
VGLL1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 59-258 of human VGLL1 (NP_057351.1). |
| Modifications | Unmodified |
Carrier-free (BSA/glycerol-free) VGLL1 mouse monoclonal antibody,clone OTI1A9
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) VGLL1 mouse monoclonal antibody,clone OTI6E1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) VGLL1 mouse monoclonal antibody,clone OTI7B8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Anti-VGLL1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 62-75 amino acids of human vestigial like 1 (Drosophila) |
Vgll1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Vgll1 |
VGLL1 mouse monoclonal antibody,clone OTI1A9
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
VGLL1 mouse monoclonal antibody,clone OTI1A9, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
VGLL1 mouse monoclonal antibody,clone OTI1A9, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
VGLL1 mouse monoclonal antibody,clone OTI1A9
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
VGLL1 mouse monoclonal antibody,clone OTI6E1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
VGLL1 mouse monoclonal antibody,clone OTI6E1, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
VGLL1 mouse monoclonal antibody,clone OTI6E1, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
VGLL1 mouse monoclonal antibody,clone OTI6E1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
VGLL1 mouse monoclonal antibody,clone OTI7B8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
VGLL1 mouse monoclonal antibody,clone OTI7B8, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
VGLL1 mouse monoclonal antibody,clone OTI7B8, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
VGLL1 mouse monoclonal antibody,clone OTI7B8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China