Antibodies

Jump to Filters
View as table Download
VMA21 Rabbit Polyclonal Antibody
TA336068

USD 310.00

5 Days

Rabbit Polyclonal Anti-VMA21 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-VMA21 Antibody: synthetic peptide directed towards the N terminal of human LOC203547. Synthetic peptide located within the following region: MERPDKAALNALQPPEFRNESSLASTLKTLLFFTALMITVPIGLYFTTKS
VMA21 Rabbit Polyclonal Antibody
TA323385

USD 345.00

4 Weeks

Anti-VMA21 Rabbit Polyclonal Antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 3-16 amino acids of human VMA21 vacuolar H+-ATPase homolog (S. cerevisiae)