Antibodies

Jump to Filters
View as table Download
VPS33A Rabbit Polyclonal Antibody
TA343192

USD 375.00

5 Days

Rabbit Polyclonal Anti-VPS33A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VPS33A antibody is: synthetic peptide directed towards the middle region of Human VPS33A. Synthetic peptide located within the following region: TYEGLIDEIYGIQNSYVKLPPEKFAPKKQGDGGKDLPTEAKKLQLNSAEE
VPS33A Rabbit Polyclonal Antibody
TA350612

USD 345.00

In Stock

Rabbit Polyclonal Anti-VPS33A Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human VPS33A
VPS33A Rabbit Polyclonal Antibody
TA365142

USD 380.00

4 Weeks

VPS33A rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human VPS33A