Antibodies

Jump to Filters
View as table Download
VPS37C Rabbit Polyclonal Antibody
TA344946

USD 475.00

5 Days

Rabbit Polyclonal Anti-VPS37C Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VPS37C antibody: synthetic peptide directed towards the N terminal of human VPS37C. Synthetic peptide located within the following region: LQLEREMALATNRSLAERNLEFQGPLEISRSNLSDRYQELRKLVERCQEQ
VPS37C (132-145) Goat Polyclonal Antibody
AP23821PU-N

USD 440.00

2 Weeks

VPS37C (132-145) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen Synthetic peptide from an internal region of human VPS37C
VPS37C Rabbit Polyclonal Antibody
TA308195

USD 415.00

5 Days

Rabbit polyclonal antibody to VPS37C (vacuolar protein sorting 37 homolog C (S. cerevisiae))

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1 and 46 of VPS37C (Uniprot ID#A5D8V6)
VPS37C Goat Polyclonal Antibody
TA303042

USD 375.00

5 Days

Goat Polyclonal Antibody against VPS37C

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-ETLKDKTLQELEELQ, from the internal region of the protein sequence according to NP_060436.4.