Germany
Japan
United Kingdom
China
Goat Anti-VPS41 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DHLKKDSQNKTLLK, from the internal region of the protein sequence according to NP_055211.2; NP_542198.2. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-VPS41 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-VPS41 antibody is: synthetic peptide directed towards the N-terminal region of Human VPS41. Synthetic peptide located within the following region: DAASCMTVHDKFLALGTHYGKVYLLDVQGNITQKFDVSPVKINQISLDES |
Rabbit Polyclonal Anti-VPS41 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VPS41 antibody: synthetic peptide directed towards the middle region of human VPS41. Synthetic peptide located within the following region: VIVQAVRDHLKKDSQNKTLLKTLAELYTYDKNYGNALEIYLTLRHKDVFQ |
Active filters
Target Symbol
- VPS41