VPS4A Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human VPS4A (NP_037377.1). |
| Modifications | Unmodified |
VPS4A Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human VPS4A (NP_037377.1). |
| Modifications | Unmodified |
Rabbit Polyclonal Anti-VPS4A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VPS4A antibody: synthetic peptide directed towards the N terminal of human VPS4A. Synthetic peptide located within the following region: YFLHAIKYEAHSDKAKESIRAKCVQYLDRAEKLKDYLRSKEKHGKKPVKE |
Rabbit Polyclonal Anti-VPS4A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VPS4A antibody: synthetic peptide directed towards the N terminal of human VPS4A. Synthetic peptide located within the following region: LRSKEKHGKKPVKENQSEGKGSDSDSEGDNPEKKKLQEQLMGAVVMEKPN |
Germany
Japan
United Kingdom
China
