Antibodies

Jump to Filters
View as table Download
VSTM5 Rabbit Polyclonal Antibody
TA334885

USD 375.00

5 Days

Rabbit Polyclonal Anti-VSTM5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VSTM5 antibody is: synthetic peptide directed towards the C-terminal region of Human VSTM5. Synthetic peptide located within the following region: HFVAVILAFLAAVAAVLISLMWVCNKCAYKFQRKRRHKLKESTTEEIELE