Antibodies

Jump to Filters
View as table Download
SLITL2 (VASN) Rabbit Polyclonal Antibody
TA383197

USD 275.00

3 Weeks

VASN Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 420-575 of human VASN (NP_612449.2).
SLITL2 (VASN) Rabbit Polyclonal Antibody
TA334395

USD 375.00

5 Days

Rabbit Polyclonal Anti-VASN Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VASN antibody is: synthetic peptide directed towards the C-terminal region of Human VASN. Synthetic peptide located within the following region: TVTQLRPNATYSVCVMPLGPGRVPEGEEACGEAHTPPAVHSNHAPVTQAR